PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P20090_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 838aa    MW: 92584.2 Da    PI: 6.535
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P20090_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.27e-191876357
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                           k  ++t+eq+e+Le+l++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr8P20090_001 18 KYVRYTPEQVEALERLYHECPKPSSLRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 76
                           5679*****************************************************97 PP

2bZIP_120.51.1e-06701131861
                            HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                            rr+R++ ++e ++L++   +L+a Nk L +e+++l+k+v++l  
  GSMUA_Achr8P20090_001  70 RRCREKQRKESAQLQTVNRKLTAMNKLLMEENDRLQKQVSQLVY 113
                            9***************************************9965 PP

3START164.38.8e-521623702205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee++ e+++ka+ ++  Wv+++ +++g++++ +++ s++++g a+ra+g+v  +++  v+e+l+d+  W + ++++++++v+ ++ 
  GSMUA_Achr8P20090_001 162 IAEETLSEFLSKATGTAVEWVQMPGMKPGPDSIGIIAISHGCTGVAARACGLVGLEPT-KVAEILKDRVSWFHECRSVDVINVLPTAn 248
                            7899******************************************************.7777777777****************999 PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g+++l +++ +a+++l+p Rdf+ vRy+  l++ ++v++++S++s    p+    +++vRae+ pSg+li+p+++g+s +++v h d
  GSMUA_Achr8P20090_001 249 nGTIELLYMQVYAPTTLAPaRDFWLVRYTSVLEDRSLVVCERSLTSMLGGPSmplVQPFVRAEMMPSGYLIRPCEGGGSVIHIVHHLD 336
                            9**********************************************9999988899******************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l+ ++++++lr+l++s+++ ++kt++a+l+++++
  GSMUA_Achr8P20090_001 337 LEPWSVPEVLRPLYESSIVLAQKTTLAALRHLRQ 370
                            *****************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.6771377IPR001356Homeobox domain
SMARTSM003897.8E-161581IPR001356Homeobox domain
SuperFamilySSF466894.23E-171782IPR009057Homeodomain-like
CDDcd000861.25E-161878No hitNo description
PfamPF000461.7E-161876IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-182076IPR009057Homeodomain-like
CDDcd146868.42E-770109No hitNo description
PROSITE profilePS5084824.26152366IPR002913START domain
CDDcd088751.07E-72156372No hitNo description
SMARTSM002342.2E-36161371IPR002913START domain
SuperFamilySSF559613.98E-36161372No hitNo description
Gene3DG3DSA:3.30.530.201.2E-19161367IPR023393START-like domain
PfamPF018521.0E-49162370IPR002913START domain
PfamPF086701.5E-48695837IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
MIPVTSCKEG KMGIDQGKYV RYTPEQVEAL ERLYHECPKP SSLRRQQLIR ECPILSNIEP  60
KQIKVWFQNR RCREKQRKES AQLQTVNRKL TAMNKLLMEE NDRLQKQVSQ LVYENGYFRQ  120
QTQNTALATT DTSCESVVTN GQHHLTPQHP PRDASPAGII SIAEETLSEF LSKATGTAVE  180
WVQMPGMKPG PDSIGIIAIS HGCTGVAARA CGLVGLEPTK VAEILKDRVS WFHECRSVDV  240
INVLPTANNG TIELLYMQVY APTTLAPARD FWLVRYTSVL EDRSLVVCER SLTSMLGGPS  300
MPLVQPFVRA EMMPSGYLIR PCEGGGSVIH IVHHLDLEPW SVPEVLRPLY ESSIVLAQKT  360
TLAALRHLRQ IAHEISHPSI SGWGRQPAAL RALSQRLSRG FNEAVNGFAD DGWSMVTTDG  420
IDDVTVFVNS STSKMMGLNL GIINGFASTS SSVLCAKASM LLQNISPPML LKFLREHRSE  480
WADRNIDAYS AAAVKATPWA LPVSRAGCYG GQVILPLAHT LDHEDFLEVI KLENFGHNQE  540
TLMPQDLYLL QLCNGVDGNA FGTCSELIFA PIDASFADEA PLLPSGFRVI PLDFKMDPTS  600
PNRTLDLASV LEVGPTGSRA SNDYSGNCGS TKSVMTIAFQ FAFESHLQEN VASMARQYIR  660
NIIASVQRLA LALSPSCLGS HVDLRIPPGN PEAVTLAHRI CHSYRAHSGV ELVKPSTDGN  720
DSLLKMLWHH SDAIVCYSMK TIPVFTFANQ AGLDMLETTL VALQDITLEK IFVDEGRKTL  780
CTEFPHIIQQ GFVCFQAGLC ISSMGRPVSY DRAVAWKVLD DEDNVHCICS MFVNWSFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009413853.10.0PREDICTED: homeobox-leucine zipper protein ATHB-15-like
SwissprotQ9ZU110.0ATB15_ARATH; Homeobox-leucine zipper protein ATHB-15
TrEMBLM0TS120.0M0TS12_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P20090_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52150.10.0HD-ZIP family protein